PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G078100.1
Common NamePHAVU_006G078100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 245aa    MW: 28059.6 Da    PI: 8.6245
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G078100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF602.9e-191053245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        +ien+s r++t+ kR++g+lKK eELS+LC+++++ i+++++++
  Phvul.006G078100.1 10 FIENDSARKTTYKKRKKGVLKKIEELSTLCGIDACAIVYGPDDH 53
                        8****************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.4149IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-23160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-7323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-171052IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MTRRKVKFAF IENDSARKTT YKKRKKGVLK KIEELSTLCG IDACAIVYGP DDHEAEVWPS  60
HCGVQRVVER FRNMPAVEKI KKMVNQESFI GQRIQKGNEQ MMKLMKDNAE KELTLFMFQC  120
LTEGRVLPDE NNMTFADLNV LSSVIEQNLK DIGKRLQTLN VNKIQPNQQP QMQTSVFQPQ  180
LKTASYQPHL QMTLMSSGHG LDMDVNPMQR LLFMDLLNGD RDETIMPPFG DPNLQFWPNL  240
GLLP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKVKFAFIENDSARKTTYKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146879.10.0hypothetical protein PHAVU_006G078100g
SwissprotQ9FJK37e-46AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV7BPB20.0V7BPB2_PHAVU; Uncharacterized protein
STRINGGLYMA18G05916.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1946255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-47AGAMOUS-like 80